PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100187770001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 160aa    MW: 18178.5 Da    PI: 9.5957
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100187770001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.29e-3943101260
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                   +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k 
  Ote100187770001|100187770001  43 PEKIIQCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAKP 101
                                   7899****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2842100IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3245100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.97847101IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MAQVQENNTS SGIKLFGATI SPKQRSQDHD RIDKSDPTAE KKPEKIIQCP RCKSMETKFC  60
YFNNYNVNQP RHFCKGCQRY WTAGGALRNV PVGAGRRKAK PPCRPGMPAF SEGCLFDAAA  120
GVQQLDXXXX XXXXXXXXXX XXXXXXXXXX XXXXXEMRYQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085996.17e-64PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotO229679e-47CDF4_ARATH; Cyclic dof factor 4
SwissprotP683509e-47DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLF6HM956e-58F6HM95_VITVI; Putative uncharacterized protein
STRINGVIT_10s0003g01260.t012e-57(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72402232